PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000950559
Common NameLOC103426993, MYB16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 256aa    MW: 28234.9 Da    PI: 8.548
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000950559genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++ +G g+W + ++  g+ R++k+c++rw +yl
    MDP0000950559 14 KGAWTKEEDDRLIAYIRAHGEGCWXSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding60.14.6e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
    MDP0000950559  67 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.9E-24564IPR009057Homeodomain-like
PROSITE profilePS5129415.945961IPR017930Myb domain
SMARTSM007173.8E-131363IPR001005SANT/Myb domain
SuperFamilySSF466892.19E-2913108IPR009057Homeodomain-like
PfamPF002499.5E-151461IPR001005SANT/Myb domain
CDDcd001671.15E-101661No hitNo description
PROSITE profilePS5129429.41162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-2865116IPR009057Homeodomain-like
SMARTSM007176.3E-1866114IPR001005SANT/Myb domain
PfamPF002493.1E-1767111IPR001005SANT/Myb domain
CDDcd001678.90E-1469112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010224Biological Processresponse to UV-B
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1903086Biological Processnegative regulation of sinapate ester biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGRSPCCEKA HTNKGAWTKE EDDRLIAYIR AHGEGCWXSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHSLLGNKWS LIAGRLPGRT DNEIKNYWNT HIRRKLLTRG  120
IDPTTHRPLN ETPQESATTI SFAAASANIK EEDKKISITN GLVCKDSKNP VQERCPDLNL  180
DLQISPPCQP QQPSDGLKSG GRGLCFSCSL GLQDAKNCSC GRDAIGGATS GTTNIGYDFL  240
GLKNGVLDYR SLEMK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-301311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.130110.0bud| flower| leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00479DAPTransfer from AT4G38620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7727870.0KF772787.1 Malus hybrid cultivar cultivar Red Splendor MYB17 mRNA, complete cds.
GenBankKF7727910.0KF772791.1 Malus hybrid cultivar cultivar Radiant MYB17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008363293.10.0PREDICTED: myb-related protein 308-like
SwissprotP813931e-125MYB08_ANTMA; Myb-related protein 308
TrEMBLD9ZJ530.0D9ZJ53_MALDO; MYB domain class transcription factor
TrEMBLW5S2990.0W5S299_9R
STRINGPOPTR_0004s18020.11e-132(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-108myb domain protein 4